S6.10 precursor (P03541) Protein Card

General Information
Name S6.10 precursor
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVLIIAVLFLTACQLATA
KTYSKGRQKHRALRSTDKN
IKLT
RR
CTPDDGACAEPVQCCSTFCNPVTNMCIDWLGIGLS
RSVL
Sequence region
[1-22]signal sequence
[23-45]pro region
[48-86]mature peptideS6.10

References
Pi,C., Liu,Y., Peng,C., Jiang,X., Liu,J., Xu,B., Yu,X., Yu,Y., Jiang,X., Wang,L., Dong,M., Chen,S. and Xu,A.L. (2006) Analysis of expressed sequence tags from the venom ducts of Conus striatus: focusing on the expression profile of conotoxins Biochimie 88:131-140

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P0C833
Ncbi P0C833

Tools