S6.7 (P03546) Protein Card

General Information
Name S6.7
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor S6.7 precursor (3545)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
CMEAGSYCGSTTRICCGYCAYSASKNVCDYPSN
Sequence evidence nucleic acid level
Average Mass 3502.86
Monoisotopic Mass 3500.30
Isoelectric Point 7.00
Extinction Coefficient [280nm] 5960.00

References
Pi,C., Liu,Y., Peng,C., Jiang,X., Liu,J., Xu,B., Yu,X., Yu,Y., Jiang,X., Wang,L., Dong,M., Chen,S. and Xu,A.L. (2006) Analysis of expressed sequence tags from the venom ducts of Conus striatus: focusing on the expression profile of conotoxins Biochimie 88:131-140

Internal links
Protein Precursor S6.7 precursor (3545)
Nucleic acids
Structure

External links
Ncbi P0C832

Tools