S4.3 (P03547) Protein Card

General Information
Name S4.3
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework IV
Pharmacological family

Sequence
QKELVPSKTTTCCGYSPGTMCPSCMCTNTCPPQK
Sequence evidence nucleic acid level
Average Mass 3620.19
Monoisotopic Mass 3617.49
Isoelectric Point 10.21
Extinction Coefficient [280nm] 1490.00

References
Pi,C., Liu,Y., Peng,C., Jiang,X., Liu,J., Xu,B., Yu,X., Yu,Y., Jiang,X., Wang,L., Dong,M., Chen,S. and Xu,A.L. (2006) Analysis of expressed sequence tags from the venom ducts of Conus striatus: focusing on the expression profile of conotoxins Biochimie 88:131-140

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P0C830
Ncbi P0C830

Tools