Sequence 318 from patent US 6797808 (P00360) Protein Card

General Information
Name Sequence 318 from patent US 6797808
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
SDGRNAAANDKASDLVALAVRGCCSNPICYFNNPRICRGRR
Average Mass 4426.01
Monoisotopic Mass 4423.14
Isoelectric Point 9.24
Extinction Coefficient [280nm] 1990.00

References
Watkins,M., Olivera,B.M., Hillyard,D.R., McIntosh,J.M. and Jones,R.M. (2002) Alpha-conotoxin peptides JP 2002534996-A 11 22-OCT-2002

Internal links
Nucleic acids
Structure

External links
Patent Lens US6797808
Ncbi AAW06200

Tools