Ml20.1 precursor (P03606) Protein Card

General Information
Name Ml20.1 precursor
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor
Notes Framework: This framework was assigned to be XII on discovery of VxXIIA , VxXIIB and VxXIIC 2006, which also had been used for conotoxins from the I superfamily (Brown et al. 2005). Loughnan et al. now propose framework designation XX (see reference).

Dimers: Mature D superfamily peptides form hetero-, homo- and pseudohomodimers (identical sequence, different posttranslational modifications). Entries for mature peptides in ConoServer are for monomers.

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Pharmacological family

Sequence
MPKLEMMLLVLLILPLSSFSAAGE
QVVQGDRRSDGLARYLQ
RGG
RDVQECQVVTPGSKWGRCCLNRVCGPMCCPASHCYCIY
HRGKGHGCSC
Sequence evidence nucleic acid level
Sequence region
[1-24]signal sequence
[25-44]pro region
[45-92]mature peptideMl20.1

References
Loughnan,M.L., Nicke,A., Lawrence,N. and Lewis,R.J. (2009) Novel alphaD-conopeptides and their precursors identified by cDNA cloning define the D-conotoxin superfamily. Biochemistry 48:3717-3729

Internal links
Nucleic acids Ml20.1 gene precursor, mRNA
Conus miles conopeptide Mi038 mRNA, complete cds.
Structure

External links
UniProtKB/Swiss-Prot C4PWC4
Ncbi CAX51122, C4PWC4

Tools