Ml20.3 precursor (P03610) Protein Card

General Information
Name Ml20.3 precursor
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor
Notes Framework: This framework was assigned to be XII on discovery of VxXIIA , VxXIIB and VxXIIC 2006, which also had been used for conotoxins from the I superfamily (Brown et al. 2005). Loughnan et al. now propose framework designation XX (see reference).

Dimers: Mature D superfamily peptides form hetero-, homo- and pseudohomodimers (identical sequence, different posttranslational modifications). Entries for mature peptides in ConoServer are for monomers.

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Pharmacological family

Sequence
MPKLEMMLLVLLILPLSYFSAAGG
QVVQGDWRGDGLARYLQ
RGDR
DAQGCQVVTPGSKWGRCCLNRVCGPMCCPASHCYCIY
HRGRGHGCSC
Sequence evidence nucleic acid level
Sequence region
[1-24]signal sequence
[25-45]pro region
[46-92]mature peptideMl20.3

References
Loughnan,M.L., Nicke,A., Lawrence,N. and Lewis,R.J. (2009) Novel alphaD-conopeptides and their precursors identified by cDNA cloning define the D-conotoxin superfamily. Biochemistry 48:3717-3729

Internal links
Nucleic acids
Structure

External links
Ncbi P0CE32

Tools