Ac6.2 (P03708) Protein Card

General Information
Name Ac6.2
Organism Conus achatinus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Ac6.2 precursor (3707)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
DECYPPGTFCGIKPGLCCSERCFPFVCLSLEF
Sequence evidence nucleic acid level
Average Mass 3556.12
Monoisotopic Mass 3553.50
Isoelectric Point 4.50
Extinction Coefficient [280nm] 1490.00

References
Gowd,K.H., Dewan,K.K., Iengar,P., Krishnan,K.S. and Balaram,P. (2008) Probing peptide libraries from Conus achatinus using mass spectrometry and cDNA sequencing: identification of delta and omega-conotoxins. J Mass Spectrom 43:791-805

Internal links
Protein Precursor Ac6.2 precursor (3707)
Nucleic acids
Structure

External links

Tools