Ac6.1 precursor (P03709) Protein Card

General Information
Name Ac6.1 precursor
Organism Conus achatinus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVVIVAVLFLTAWTFVMA
DDSRYGLKDLFPKARHEMK
NPEASKLNKR
DECFSPGTFCGIKPGLCCSAWCYSFFCLTLT
F
Sequence region
[1-22]signal sequence
[23-51]pro region
[52-83]mature peptideAc6.1

References
Gowd,K.H., Dewan,K.K., Iengar,P., Krishnan,K.S. and Balaram,P. (2008) Probing peptide libraries from Conus achatinus using mass spectrometry and cDNA sequencing: identification of delta and omega-conotoxins. J Mass Spectrom 43:791-805

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P0C8V5
Ncbi P0C8V5

Tools