Ac6.1 (P03710) Protein Card

General Information
Name Ac6.1
Organism Conus achatinus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Ac6.1 precursor (3709)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
DECFSPGTFCGIKPGLCCSAWCYSFFCLTLTF
Sequence evidence nucleic acid level
Average Mass 3542.09
Monoisotopic Mass 3539.45
Isoelectric Point 4.50
Extinction Coefficient [280nm] 6990.00

References
Gowd,K.H., Dewan,K.K., Iengar,P., Krishnan,K.S. and Balaram,P. (2008) Probing peptide libraries from Conus achatinus using mass spectrometry and cDNA sequencing: identification of delta and omega-conotoxins. J Mass Spectrom 43:791-805

Internal links
Protein Precursor Ac6.1 precursor (3709)
Nucleic acids
Structure

External links

Tools