Ac6.5 (P03788) Protein Card

General Information
Name Ac6.5
Organism Conus achatinus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Ac6.5 precursor (3702)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
ATDCIEAGNYCGPTVMKICCGFCSPFSKICMNYPQN
Sequence evidence nucleic acid level
Average Mass 3904.51
Monoisotopic Mass 3901.59
Isoelectric Point 7.00
Extinction Coefficient [280nm] 2980.00

References
Gowd,K.H., Dewan,K.K., Iengar,P., Krishnan,K.S. and Balaram,P. (2008) Probing peptide libraries from Conus achatinus using mass spectrometry and cDNA sequencing: identification of delta and omega-conotoxins. J Mass Spectrom 43:791-805

Internal links
Protein Precursor Ac6.5 precursor (3702)
Nucleic acids
Structure

External links

Tools