T6.1 (P03792) Protein Card

General Information
Name T6.1
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor T6.1 precursor (850)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
QVSWWCGKPEATCGKLYLKCCSGMCNKANWKCL
Sequence evidence nucleic acid level
Average Mass 3734.43
Monoisotopic Mass 3731.64
Isoelectric Point 10.95
Extinction Coefficient [280nm] 17990.00

References

Internal links
Protein Precursor T6.1 precursor (850)
Nucleic acids
Structure

External links

Tools