Ca11.3 precursor (P03797) Protein Card

General Information
Name Ca11.3 precursor (named by ConoServer)
Alternative name(s) Ca-25 precursor
Organism Conus caracteristicus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily I3 superfamily
Pharmacological family

Sequence
MKLVLAIVVILMLLSLSTGA
EMSDNHASRSATALRDRLLSP
K
ASICYGTGGRCTKDKHCCGWLCCGGPSVGCVVSVAPCK
Sequence evidence nucleic acid level
Sequence region
[1-20]signal sequence
[21-42]pro region
[43-80]mature peptideCa11.3

References
Yuan,D.D., Liu,L., Shao,X.X., Peng,C., Chi,C.W. and Guo,Z.Y. (2009) New conotoxins define the novel I3-superfamily. Peptides 30:861-865
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Nucleic acids 11.3 mRNA, complete cds
Structure

External links
Ncbi ACU30042, D2DGD5

Tools