Ca11.3 (P03798) Protein Card

General Information
Name Ca11.3
Organism Conus caracteristicus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ca11.3 precursor (3797)

Classification
Conopeptide class conotoxin
Gene superfamily I3 superfamily
Cysteine framework XI
Pharmacological family

Sequence
ASICYGTGGRCTKDKHCCGWLCCGGPSVGCVVSVAPC
Sequence evidence nucleic acid level
Average Mass 3671.25
Monoisotopic Mass 3668.50
Isoelectric Point 10.47
Extinction Coefficient [280nm] 6990.00

References
Yuan,D.D., Liu,L., Shao,X.X., Peng,C., Chi,C.W. and Guo,Z.Y. (2009) New conotoxins define the novel I3-superfamily. Peptides 30:861-865

Internal links
Protein Precursor Ca11.3 precursor (3797)
Nucleic acids
Structure

External links

Tools