Mr6 precursor (P03857) Protein Card

General Information
Name Mr6 precursor
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily M superfamily
Pharmacological family

Sequence
MSKLGVVLLIFVVLLALTS
PHHYGNRFAGYQARQMGVQQRK
NALANALRRS
GCGYLGEPCCVAPKRAYCHGDLECNNVAMCV
N
Sequence region
[1-19]signal sequence
[52-83]mature peptideMr6

References

Internal links
Nucleic acids Mr6, mRNA, complete cds
Structure

External links
Ncbi ACV87166

Tools