Mr12.8 precursor (P03858) Protein Card

General Information
Name Mr12.8 precursor
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily I2 superfamily
Pharmacological family

Sequence
MFGHTSVSFLLLSIVALGMVATVIC
SCDSEFSSEFCEQPEE
RICSCSTHVCCHLSSSKGDQCMTWNRCLSAQTGN
RRSTHMQ
KRFLRMPRDLAD
Sequence region
[1-25]signal sequence
[26-75]mature peptideMr12.8

References
Liu,Z., Yu,Z., Liu,N., Zhao,C., Hu,J. and Dai,Q. (2010) cDNA cloning of conotoxins with framework XII from several Conus species. Acta Biochim. Biophys. Sin. (Shanghai) 42:656-661

Internal links
Nucleic acids Conus marmoreus conotoxin Mr12.8 mRNA, complete cds.
Structure

External links
UniProtKB/Swiss-Prot C8BLS3
Ncbi ACV13221

Tools