Eu12.4 precursor (P03861) Protein Card

General Information
Name Eu12.4 precursor (named by ConoServer)
Alternative name(s) Eb12.4
Organism Conus eburneus
Organism diet generalist
Protein Type Precursor
Notes This peptide, extracted from Conus eburneus, was originally published under the name "Eb12.4" but the abbreviation "Eb" was already in used for peptides extracted from Conus ebraeus. Therefore the peptide was rename "Eu12.4".

Classification
Conopeptide class conotoxin
Gene superfamily I2 superfamily
Pharmacological family

Sequence
MFGHTSVSFLLLSIMALGMVATVIC
SCDSEFSSEFCEQPEE
RICSCSTHVCCHLSSSKRDQCMTWNRCLSAQTGN
RRSTHMQ
KRFLRMPRDLAD
Sequence region
[1-25]signal sequence
[26-75]mature peptideEu12.4

References
Liu,Z., Yu,Z., Liu,N., Zhao,C., Hu,J. and Dai,Q. (2010) cDNA cloning of conotoxins with framework XII from several Conus species. Acta Biochim. Biophys. Sin. (Shanghai) 42:656-661

Internal links
Nucleic acids Eb12.4 mRNA, complete cds.
Structure

External links
UniProtKB/Swiss-Prot C8BLS0
Ncbi ACV13218

Tools