Lt12.9 precursor (P03862) Protein Card

General Information
Name Lt12.9 precursor
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily I2 superfamily
Pharmacological family

Sequence
MFGHTSVSFLLLSIMVLGVVATVIC
SCGVRISSEICEQPEE
RICSCSNHMCCPLNPSQRDQCMARNVCFIMIGIYG
GRRSTR
MQERFLRMSRGLADYSV
Sequence region
[1-25]signal sequence
[26-76]mature peptideLt12.9

References
Liu,Z., Yu,Z., Liu,N., Zhao,C., Hu,J. and Dai,Q. (2010) cDNA cloning of conotoxins with framework XII from several Conus species. Acta Biochim. Biophys. Sin. (Shanghai) 42:656-661

Internal links
Nucleic acids Lt12.9 mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot C8BLR9
Ncbi ACV13217

Tools