Ca15a precursor (P03864) Protein Card

General Information
Name Ca15a precursor
Organism Conus caracteristicus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MEKLTILILVATVLLAIQVLVQS
DREKPLKGRVKQYAAKRL
SALLRGPR
ECTPMHRACEEDEECCPNLECKCSSNPDCQSGY
KCRP
Sequence region
[1-23]signal sequence
[50-86]mature peptideCa15a

References

Internal links
Nucleic acids Ca15a precursor, mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot C8CK80
Ncbi ACV07673

Tools