Eu12.4 (P03877) Protein Card

General Information
Name Eu12.4
Alternative name(s) Eb12.4
Organism Conus eburneus
Organism diet piscivorous
Protein Type Wild type
Protein precursor Eu12.4 precursor (3861)
Notes This peptide, extracted from Conus eburneus, was originally published under the name "Eb12.4" but the abbreviation "Eb" was already in used for peptides extracted from Conus ebraeus. Therefore the peptide was rename "Eu12.4".

Classification
Conopeptide class conotoxin
Gene superfamily I2 superfamily
Cysteine framework XII
Pharmacological family

Sequence
SCDSEFSSEFCEQPEERICSCSTHVCCHLSSSKRDQCMTWN
RCLSAQTGN
Sequence evidence nucleic acid level
Average Mass 5644.13
Monoisotopic Mass 5640.22
Isoelectric Point 5.25
Extinction Coefficient [280nm] 5500.00

References
Liu,Z., Yu,Z., Liu,N., Zhao,C., Hu,J. and Dai,Q. (2010) cDNA cloning of conotoxins with framework XII from several Conus species. Acta Biochim. Biophys. Sin. (Shanghai) 42:656-661

Internal links
Protein Precursor Eu12.4 precursor (3861)
Nucleic acids
Structure

External links

Tools