Ca15a (P03883) Protein Card

General Information
Name Ca15a
Organism Conus caracteristicus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework XV
Pharmacological family

Sequence
ECTPMHRACEEDEECCPNLECKCSSNPDCQSGYKCRP
Sequence evidence nucleic acid level
Average Mass 4188.58
Monoisotopic Mass 4185.53
Isoelectric Point 4.72
Extinction Coefficient [280nm] 1490.00

References

Internal links
Nucleic acids
Structure

External links

Tools