con-ikot-ikot (P03891) Protein Card

General Information
Name con-ikot-ikot
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor con-ikot-ikot precursor (3890)
Notes The first 27 amino-acids have been sequenced by Edman degradation. Con-ikot-ikot blocks desensitization of AMPA receptors (no pharmacological family name yet). X-ray crystallographic data indicates that it acts as a dimeric complex. Agonist is required for toxin-receptor binding. Toxin spans the receptorgating ring, between the amino-terminal and ligand-binding domain layers. (Chen et al., 2014)

Classification
Conopeptide class con-ikot-ikot
Gene superfamily
Pharmacological family

Sequence
SGPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATV
TCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCG
NPCA
Sequence evidence nucleic acid level
Average Mass 9432.69
Monoisotopic Mass 9425.97
Isoelectric Point 7.88
Extinction Coefficient [280nm] 6085.00

References
Walker,C.S., Jensen,S., Ellison,M., Matta,J.A., Lee,W.Y., Imperial,J.S., Duclos,N., Brockie,P.J., Madsen,D.M., Isaac,J.T., Olivera,B. and Maricq,A.V. (2009) A novel Conus snail polypeptide causes excitotoxicity by blocking desensitization of AMPA receptors. Curr. Biol. 19:900-908
Chen,L., Dürr,K.L. and Gouaux,E. (2014) X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism. Science 345:1021-1026

Internal links
Protein Precursor con-ikot-ikot precursor (3890)
Nucleic acids
Structure Crystal structure of con-ikot-ikot toxin (1)
Crystal structure of con-ikot-ikot toxin (2)
Crystal structure of GluA2, con-ikot-ikot snail toxin, partial agonist FW and postitive modulator (R,R)-2b complex
Crystal structure of GluA2, con-ikot-ikot snail toxin, partial agonist KA and postitive modulator (R,R)-2b complex
Crystal structure of GluA2 T625G, con-ikot-ikot snail toxin, partial agonist KA and postitive modulator (R,R)-2b complex
Crystal structure of GluA2, con-ikot-ikot snail toxin, partial agonist KA and postitive modulator (R,R)-2b complex, GluA2cryst2 construct
Crystal structure of GluA2 A622T, con-ikot-ikot snail toxin, partial agonist KA and postitive modulator (R,R)-2b complex

External links

Tools