A1.4 precursor (P03916) Protein Card

General Information
Name A1.4 precursor
Organism Conus aurisiacus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework I
Pharmacological family

Sequence
IRVVLGPASDGRDDEAKDKRSDMYESDRNGR
CCHPSCGRKY
NC
GR
Sequence region
[32-43]mature peptideA1.4

References

Internal links
Nucleic acids Conus aurisiacus isolate A1.4 superfamily conotoxin gene, partialcds.
Structure

External links
Ncbi ACZ49747

Tools