Cal9.1d precursor (P03965) Protein Card

General Information
Name Cal9.1d precursor
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
RTKR
DVCELPFEEGPCFAAIRVYAYNAKTGDCEQLTYGGCE
GNGNRFATLEDCDNACARY
Sequence region
[5-60]mature peptideCal9.1d

References
Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links
Nucleic acids Conus californicus isolate BA10-58B02 conotoxin Cal 9.1d precursor, mRNA, partial cds.
Structure

External links
UniProtKB/Swiss-Prot D2Y491
Ncbi ADB04234, D2Y491

Tools