Cal6.3a precursor (P03967) Protein Card

General Information
Name Cal6.3a precursor
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily Divergent MRFLHFLIVA
Pharmacological family

Sequence
MRFLHFLIVAVLLASFMESGA
MPRNPKKKR
GWDTPAPCRYC
QWNGPQCCVYYCSSCNYEEAREEGHYVSSHLLERQ
GR
Sequence region
[1-21]signal sequence
[31-76]mature peptideCal6.3a

References

Internal links
Nucleic acids Conus californicus isolate W-66 conotoxin Cal 6.3a precursor, mRNA, complete cds.
Structure

External links
UniProtKB/Swiss-Prot D2Y493
Ncbi ADB04236, D2Y493

Tools