Cal6.3b precursor (P03968) Protein Card

General Information
Name Cal6.3b precursor
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
KKKR
GWDTPAPCHYCQWKGPQCCVYYCSSCNYEEAREEGHY
VSSHLLERQ
GR
Sequence region
[5-50]mature peptideCal6.3b

References

Internal links
Nucleic acids Conus californicus isolate Q-164 conotoxin Cal 6.3b precursor, mRNA, partial cds.
Structure

External links
UniProtKB/Swiss-Prot D2Y494
Ncbi ADB04237, D2Y494

Tools