RVIIIA precursor (P04000) Protein Card

General Information
Name RVIIIA precursor
Organism Conus radiatus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily S superfamily
Pharmacological family

Sequence
MMSKMGAMFVLLLLFTLAS
SQQEGDVQARKTHPKREFQRIL
LRSGR
KCNFDKCKGTGVYNCGESCSCEGLHSCRCTYNIGSM
KSGCACICTYY
Sequence region
[1-19]signal sequence
[47-93]mature peptideRVIIIA

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Nucleic acids Conus radiatus conotoxin RVIIIa gene, partial cds.
Structure

External links
Ncbi ADB93084

Tools