Cl12.1 precursor (P04009) Protein Card

General Information
Name Cl12.1 precursor
Alternative name(s) Cal12.2d (partial)
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVLVVLLLVLPFGDL
ITTSNTEDNKRGATPWQNSLKA
R
GVCSTPEGSCVHNGCICQNAPCCHASGCNWANVCPGFLWD
KN
Sequence region
[1-19]signal sequence
[43-84]mature peptideCl12.1

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12
Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links
Nucleic acids Cal12.2d mRNA, partial cds
Conus californicus conotoxin Cl12.1 gene, partial cds.
Structure

External links
UniProtKB/Swiss-Prot A7LI92
Ncbi ABS59787, A7LI92, ADB93093

Tools