CalTx 12.1.4C precursor (P04010) Protein Card

General Information
Name CalTx 12.1.4C precursor
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVLVVLLLLLPYGDL
ITNSYIRGAARKVTPWRRNLKT
R
DVCDSLVDGRCIHNGCFCEESKPNGNCCDTGGCVWWWCPG
TKWD
Sequence region
[1-19]signal sequence
[43-86]mature peptideCal12.1.3a

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Nucleic acids Conus californicus conotoxin Cl12.2 gene, partial cds.
Structure

External links
Ncbi ADB93094

Tools