Cl14.10 precursor (P04012) Protein Card

General Information
Name Cl14.10 precursor
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
NER
HVTCFYVKFGCKHTECITTIVFCWQTASDISSV
Sequence region
[4-36]mature peptideCl14.10

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Nucleic acids Conus californicus conotoxin Cl14.10 gene, partial cds.
Structure

External links
UniProtKB/Swiss-Prot D6C4I4
Ncbi ADB93096, D6C4I4

Tools