Cal14.10 precursor (P04012) Protein Card

General Information
Name Cal14.10 precursor
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
NER
HVTCFYVKFGCKHTECITTIVFCWQTASDISSV
Sequence region
[4-36]mature peptideCal14.10

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Nucleic acids Cal14.10 precursor
Structure

External links
UniProtKB/Swiss-Prot D6C4I4
Ncbi ADB93096, D6C4I4

Tools