Cl6.15 precursor (P04031) Protein Card

General Information
Name Cl6.15 precursor
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily I1 superfamily
Pharmacological family

Sequence
MKLSVKFLLFLMILPLIAG
EDMSDNDAPKSVDVQRNVKR
QG
QSQFGEQCTGHLDCFGDLCCFDGYCIMTSWIWPCNW
Sequence region
[1-19]signal sequence
[40-77]mature peptideCl6.15

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Nucleic acids Conus californicus conotoxin Cl6.15 gene, partial cds.
Structure

External links
UniProtKB/Swiss-Prot D6C4K5
Ncbi ADB93117, D6C4K5

Tools