Cal9.2c precursor (P04046) Protein Card

General Information
Name Cal9.2c precursor
Alternative name(s) Cl9.3 precursor
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor
Notes Biggs et al. predict a different mature toxin: FPCNAGNCACLPLDSYSYTCQSPTSSTANCEGNECRSEADW. We chose here to follow the Elliger et al. mature peptide prediction.

Conopeptide class conotoxin
Gene superfamily Divergent M---L-LTVA
Pharmacological family

Sequence region
[1-18]signal sequence
[35-79]mature peptideCal9.2c

Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12
Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links
Nucleic acids Conus californicus conotoxin Cl9.3 gene, partial cds.

External links
Ncbi ADB93132, D6C4M0
