conotoxin CalMKLL-2 precursor (P04056) Protein Card

General Information
Name conotoxin CalMKLL-2 precursor
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily Divergent MKLLLTLLLG
Pharmacological family

Sequence
MKLLLTLLLGSALMCITLA
DECGLGTHRPVKEVIDNVRTMY
YCDCRAGDAERSITVSRCDDNNQKQDDVILTYCGLEQTTGC
NTNPYTAAKHDSSGDKPQFYCSCLNYKYEQSHADSRYWTIR
CYMGDICD
Sequence region
[1-19]signal sequence

References
Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links
Nucleic acids Conus californicus isolate Cl-88 conotoxin CalMKLL-2 precursor, mRNA, complete cds.
Structure

External links
UniProtKB/Swiss-Prot D3JYA6
Ncbi ADC35042, D3JYA6

Tools