C4.2 (P04081) Protein Card

General Information
Name C4.2
Organism Conus catus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor C4.2 precursor (3924)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily A superfamily
Cysteine framework IV
Pharmacological family

Sequence
QKELVVTATTTCCGYNPMSMCPKCMCTYSCPHQKKKRP
Sequence evidence nucleic acid level
Average Mass 4292.10
Monoisotopic Mass 4288.90
Isoelectric Point 10.96
Extinction Coefficient [280nm] 2980.00

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Protein Precursor C4.2 precursor (3924)
Nucleic acids
Structure

External links

Tools