Cr4.2 (P04089) Protein Card

General Information
Name Cr4.2
Organism Conus circumcisus (circumcision cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cr4.2 precursor (3932)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework IV
Pharmacological family

Sequence
APWTVVLSTTNCCGYNTMEFCPACMCTYSCPKKKKPGK
Sequence evidence nucleic acid level
Average Mass 4186.94
Monoisotopic Mass 4183.83
Isoelectric Point 10.68
Extinction Coefficient [280nm] 8480.00

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Protein Precursor Cr4.2 precursor (3932)
Nucleic acids
Structure

External links

Tools