Cn4.2 (P04095) Protein Card

General Information
Name Cn4.2
Organism Conus consors
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cn4.2 precursor (3938)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily A superfamily
Cysteine framework IV
Pharmacological family

Sequence
QKDLVVTATTTCCGYNPMTICPPCMCTYSCPPKKKKP
Sequence evidence nucleic acid level
Average Mass 4046.84
Monoisotopic Mass 4043.83
Isoelectric Point 10.64
Extinction Coefficient [280nm] 2980.00

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Protein Precursor Cn4.2 precursor (3938)
Nucleic acids
Structure

External links

Tools