Mn4.3 (P04108) Protein Card

General Information
Name Mn4.3
Organism Conus monachus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Mn4.3 precursor (3951)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework IV
Pharmacological family

Sequence
QKDLVVTATTTCCGYNPMTMCPPCMCTNTC
Sequence evidence nucleic acid level
Average Mass 3225.78
Monoisotopic Mass 3223.24
Isoelectric Point 7.00
Extinction Coefficient [280nm] 1490.00

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Protein Precursor Mn4.3 precursor (3951)
Nucleic acids
Structure

External links

Tools