Cal9.1c (P04119) Protein Card

General Information
Name Cal9.1c
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cal9.1c precursor (3964)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework IX
Pharmacological family

Sequence
DVCELPFEEGPCFAAIRVYAYNAETGNCEQLTYGGCEGNGN
RFATLEDCDNACARY
Sequence evidence nucleic acid level
Average Mass 6129.63
Monoisotopic Mass 6125.54
Isoelectric Point 4.14
Extinction Coefficient [280nm] 5960.00

References
Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links
Protein Precursor Cal9.1c precursor (3964)
Nucleic acids
Structure

External links

Tools