Cl11.1 (P04152) Protein Card

General Information
Name Cl11.1
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cl11.1 precursor (4007)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily I1 superfamily
Cysteine framework XI
Pharmacological family

Sequence
KFNENLSELNSACDDAWETCAWSRTCCSRNCCRGICVSRYY
ECP
Sequence evidence nucleic acid level
Average Mass 5080.60
Monoisotopic Mass 5077.03
Isoelectric Point 5.20
Extinction Coefficient [280nm] 13980.00

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Protein Precursor Cl11.1 precursor (4007)
Nucleic acids
Structure

External links

Tools