Cl12.1 (P04154) Protein Card

General Information
Name Cl12.1
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cl12.1 precursor (4009)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework XII
Pharmacological family

Sequence
GVCSTPEGSCVHNGCICQNAPCCHASGCNWANVCPGFLWDK
N
Sequence evidence nucleic acid level
Average Mass 4375.86
Monoisotopic Mass 4372.70
Isoelectric Point 6.81
Extinction Coefficient [280nm] 11000.00

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12
Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links
Protein Precursor Cl12.1 precursor (4009)
Nucleic acids
Structure

External links

Tools