Cl6.3 (P04175) Protein Card

General Information
Name Cl6.3
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cl6.3 precursor (4036)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
GLSRPSKGCIGGGDPCEFHRGYTCCSEHCIIWVCA
Sequence evidence nucleic acid level
Average Mass 3737.24
Monoisotopic Mass 3734.57
Isoelectric Point 8.31
Extinction Coefficient [280nm] 6990.00

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Protein Precursor Cl6.3 precursor (4036)
Nucleic acids
Structure

External links

Tools