Cl9.6 (P04186) Protein Card

General Information
Name Cl9.6
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cl9.6 precursor (4049)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily Divergent MSTLGMTLL-
Cysteine framework IX
Pharmacological family

Sequence
GQGGCVPPGGGRCKANQACTKGGNPGTCGFQYDLCLCLRN
Sequence evidence nucleic acid level
Average Mass 3996.51
Monoisotopic Mass 3993.74
Isoelectric Point 11.12
Extinction Coefficient [280nm] 1490.00

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Protein Precursor Cl9.6 precursor (4049)
Nucleic acids
Structure

External links

Tools