Conantokin-Br precursor (P04202) Protein Card

General Information
Name Conantokin-Br precursor
Organism Conus sulcatus
Organism region Indo-Pacific
Protein Type Precursor

Classification
Conopeptide class conantokin
Gene superfamily B1 superfamily
Pharmacological family

Sequence
MQLYTYLYLLVPLVTFHLILG
TGTLDHGGALTERRSTDATA
LKPEPVLQKSAARSTDDNGKDRLTQMKRILKKRGKNAR
GDE
EYSKFIEREREAGRLDLSKFP
Sequence region
[1-21]signal sequence
[80-103]mature peptideConantokin-Br

References
Twede,V.D., Teichert,R.W., Walker,C.S., Gruszczynski,P., Kazmierkiewicz,R., Bulaj,G. and Olivera,B.M. (2009) Conantokin-Br from Conus brettinghami and selectivity determinants for the NR2D subunit of the NMDA receptor. Biochemistry 48:4063-4073

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P0CG46
Ncbi P0CG46

Tools