PrXA precursor (P04224) Protein Card

General Information
Name PrXA precursor
Organism Conus parius
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor
Notes The superfamily corresponding to the signal sequence has not been named yet.

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MQTAYWVMVMMMVMWITAPLSEG
GKPKLIIRGLVPNDLTPQ
RILRSLISGR
TYGIYDAKPPFSCAGLRGGCVLPPNLRPKFK
E
GR
Sequence region
[1-23]signal sequence
[52-83]mature peptidePrXA

References

Internal links
Nucleic acids Conus parius alpha conotoxin C-superfamily protein mRNA, partial cds.
Structure

External links
Ncbi ADN79120

Tools