Vc6.11 precursor (P04272) Protein Card

General Information
Name Vc6.11 precursor
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor
Notes The sequence presented here is the one in the article Safavi-Hemami et al. The sequence differs in position 7 of the domain from the one translated from the nucleic acid sequence submitted in GenBank (substitution C7R). The authors have been contacted and replied a mistake occur in the nucleic acid sequence submitted to GenBank.

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MEKLTILLLVAAVLMSTQALI
QEQRQKAKINLFSKRKPSAE
R
WWGENDCRVFGSCTADEECCFNNCVQAYCFFV
Sequence region
[1-21]signal sequence
[43-74]mature peptideVc6.11

References
Safavi-Hemami,H., Siero,W.A., Kuang,Z., Williamson,N.A., Karas,J.A., Page,L.R., MacMillan,D., Callaghan,B., Kompella,S.N., Adams,D.J., Norton,R.S., and Purcell,A.W. (2011) Embryonic toxin expression in the cone snail Conus victoriae: primed to kill or divergent function? J. Biol. Chem. 286:22546-22557

Internal links
Nucleic acids Vc6.11 precursor
Structure

External links
UniProtKB/Swiss-Prot G1AS77
Ncbi AEA35360, G1AS77

Tools