Sequence 49 from patent US 6855805 (P00448) Protein Card

General Information
Name Sequence 49 from patent US 6855805
Organism Unknown
Protein Type Patent

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MFTVFLLVVLTTTVVSFPSDSASGGRDDEAKDERSDMYELK
RNGHCCHPACGGKYVKCGR
Average Mass 6586.49
Monoisotopic Mass 6582.11
Isoelectric Point 7.51
Extinction Coefficient [280nm] 3480.00

References
Olivera,B.M., Layer,R.T., McIntosh,J.M., Nielsen,J.S. and Jones,R.M. (2005) Alpha.-conotoxin peptides Patent: US 6855805 15-FEB-2005

Internal links
Nucleic acids Sequence 48 from patent US 6855805
Structure

External links
Patent Lens US6855805
Ncbi AAY01232

Tools