Conantokin-Eu1 precursor (P04495) Protein Card

General Information
Name Conantokin-Eu1 precursor
Organism Conus eburneus
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conantokin
Gene superfamily B1 superfamily
Pharmacological family

Sequence
MHLYTYLYLLVPLVTFHLILG
TGTLAHGGALTERRSADATA
LKPEPVLLQKSAARSTDDNGKDRLTQMNRILKKRGNAAR
DA
EEVRESAETLHEISVY
Sequence region
[1-21]signal sequence
[81-98]mature peptideConantokin-Eu1

References

Internal links
Nucleic acids Conantokin E1 precursor, mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot F2W8A2
Ncbi ADZ72979

Tools