Vi6.7 precursor (P04518) Protein Card

General Information
Name Vi6.7 precursor
Organism Conus virgo
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O3 superfamily
Pharmacological family

Sequence
MSGLGIMVLTLLLLVFMVTSHQ
DSGEKRATQRNAINVRRRR
SIIRR
TVDEACNEYCEERNKNCCGRTDGEPVCAQACL
G
Sequence region
[1-22]signal sequence
[47-78]mature peptideVi6.7

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Nucleic acids Vi6.7 mRNA, complete cds.
Structure

External links
Ncbi ADZ99321, ADZ74136

Tools