Vi6.7 (P04519) Protein Card

General Information
Name Vi6.7
Organism Conus virgo
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Vi6.7 precursor (4518)
Notes Predicted by ConoServer.

Classification
Conopeptide class conotoxin
Gene superfamily O3 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
TVDEACNEYCEERNKNCCGRTDGEPVCAQACL(nh2)
Modified residues
positionsymbolname
33nh2C-term amidation
Sequence evidence nucleic acid level
Average Mass 3517.82
Monoisotopic Mass 3515.37
Isoelectric Point 4.62
Extinction Coefficient [280nm] 1490.00

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Protein Precursor Vi6.7 precursor (4518)
Nucleic acids
Structure

External links

Tools