Im6.6 precursor (P04524) Protein Card

General Information
Name Im6.6 precursor
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MKLTILLLVAALLVLTQALT
ERRRVKWQKR
SSTYDDEIATF
CWSYWIGFQYSYPYTYVQPCTALGKACTANSDCCSKYCNTK
ICKINWE
G
Sequence region
[1-20]signal sequence
[31-89]mature peptideIm6.6

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Nucleic acids Conus imperialis conotoxin Im6.6 mRNA, complete cds.
Structure

External links
Ncbi ADZ74139

Tools