Im9.11 precursor (P04525) Protein Card

General Information
Name Im9.11 precursor
Alternative name(s) Im24.11,Im5.3
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor
Notes Liu 2012 claimed this peptide to display a new cysteine framework but it has the cysteine framework IX cysteine pattern, which was published in 2000 and for which many corresponding conotoxins have been discovered. The signal sequence has not enough alignment identity with known precursors to be classified in a gene superfamily, therefore this sequence might represents the first of a new gene superfamily.

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MLKVGVVLLIFLVLMSSA
IPQDRGQQSDKKQIRQRDIFGSK
MRRYSPNIQKR
CIVGTPCHVCRSQSKSCNGWLGKQRYCGYC
G
Sequence region
[1-18]signal sequence
[53-82]mature peptideIm9.11

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Nucleic acids Conotoxin Im9.11 mRNA, complete cds.
Structure

External links
Ncbi ADZ74142

Tools